LL-37 10mg
The LL-37 antimicrobial peptide is a crucial, naturally occurring component of the human innate immune system. As the sole cathelicidin-derived peptide in humans, this 37-amino-acid molecule (derived from hCAP-18) serves as a first line of defense. Research into the LL-37 antimicrobial peptide has revealed its multifaceted role in host protection, demonstrating not only direct microbial killing but also significant immunomodulatory and tissue-repair functions.
- Product Introduction
High Purity LL-37 Antimicrobial Peptide for Research
The LL-37 antimicrobial peptide is a crucial, naturally occurring component of the human innate immune system. As the sole cathelicidin-derived peptide in humans, this 37-amino-acid molecule (derived from hCAP-18) serves as a first line of defense. Research into the LL-37 antimicrobial peptide has revealed its multifaceted role in host protection, demonstrating not only direct microbial killing but also significant immunomodulatory and tissue-repair functions.
Customized Solutions and Reliable Supply
As both a manufacturer and trader, we offer flexible, scalable production and sourcing options tailored to client needs. Our expertise in material properties and process optimization allows us to deliver peptides with excellent durability, uniformity, and performance-supported by thorough documentation and traceability.
These capabilities position us as a trusted partner for high-quality peptide supply, from synthesis and lyophilization to global distribution.
Benefits & Uses of LL-37
Broad-Spectrum Antimicrobial – Effective against gram-positive & gram-negative bacteria, fungi, and viruses.
Wound Healing & Tissue Regeneration – Promotes angiogenesis and accelerates skin repair.
Anti-Inflammatory Properties – Modulates immune responses and reduces excessive inflammation.
Biofilm Disruption – Breaks down microbial biofilms, aiding in chronic wound and infection research.
Immune System Modulation – Supports both innate and adaptive immune responses in studies.
Molecular Structure
Sequence: [LL-37, 37 aa]
Molecular Formula: C_205H_340N_56O_53
Molecular Weight: ~4493.3 g/mol
Form: Lyophilized white powder
Purity: ≥99% (HPLC Tested)
Mechanism of Action
LL-37 functions by:
Binding and disrupting microbial membranes, causing rapid pathogen death
Modulating cytokine production via immune receptors.
Supporting angiogenesis and tissue regeneration in wound healing models.
This dual antimicrobial + immunomodulatory profile makes LL-37 antimicrobial peptide a unique research candidate compared to traditional antibiotics.
LL-37 vs. Similar Peptides
|
Feature |
LL-37 |
Human Beta Defensin-2 (HBD-2) |
Melittin |
|
Origin |
Human cathelicidin |
Human defensin |
Bee venom |
|
Antimicrobial Range |
Broad-spectrum |
Primarily bacteria |
Broad but cytotoxic |
|
Wound Healing |
Strong |
Moderate |
Weak |
|
Inflammation Control |
Strong |
Moderate |
Low |
|
Cytotoxicity |
Low (research conditions) |
Low |
High |
LL-37 stands out for its broad antimicrobial coverage, low cytotoxicity, and wound-healing capacity, making it superior for translational research.
Storage & Safety
Storage: Lyophilized peptide should be stored at –20°C for long-term use. Once reconstituted, keep at 2–8°C and use within a few weeks.
Handling: For research use only. Not for human consumption.
Stability: Stable for at least 24 months as lyophilized powder under proper storage conditions
Possible Side Effects
Mild local irritation at injection site
Dose-dependent cytotoxicity in certain cell types at high concentrations
No systemic toxicity reported in typical laboratory concentrations
Why Choose Us as Your LL-37 Supplier?
GMP-Certified Manufacturing – Pharmaceutical-grade processes for maximum purity.
HPLC & MS Tested – Guaranteed ≥99% purity.
Competitive Pricing – Wholesale & bulk supply options.
Fast Worldwide Shipping – Secure, discreet packaging.
Dedicated Customer Support – Responsive technical assistance.
Order LL-37 10mg Now – Limited Stock Available!
Contact us for wholesale/bulk inquiries
Fast, discreet shipping worldwide
Contact us today for discounted LL-37 peptide pricing and research supply inquiries.
Pls feel free to contact Vic for any questions:
Whatsapp:+852 9433 2308
Telegram: Your Telegram
Email: Jdy_gsyg@163.com
Our Advantages
End-to-End Peptide Production Capabilities
We provide a fully integrated manufacturing process-from solution preparation using stainless steel mixing tanks, sterile filtration via ultrafiltration systems, aseptic filling under laminar flow hoods, to lyophilization under strict temperature and pressure control. This ensures high purity, stability, and sterility of our peptide products, meeting stringent pharmaceutical and biotech industry standards.
Laboratory Display
Mode of Transport
Payment Method
Hot Tags
LL-37 10mg, LL-37 antimicrobial peptide, LL-37 peptide, wound healing peptide, immune modulation peptide, anti-inflammatory peptide, antimicrobial research peptide, cathelicidin peptide, infection research peptide, biofilm disruption peptide
Meta Description
LL-37 10mg – High-purity LL-37 antimicrobial peptide (≥99% HPLC tested). Broad-spectrum activity, wound healing, and immune modulation. GMP-grade, fast worldwide shipping.
Hot Tags: ll-37 10mg, China ll-37 10mg manufacturers, suppliers, factory, LL 37 10mg, KPV 10 Mg, HEP 1 2mg, Human ezrin peptide, Ara 290 5mg, TB 500 5mg
You Might Also Like
